Monday's Molecule #54

 
Name this molecule. Make sure you get the correct scientific name and the correct form of the molecule.

There's an indirect connection between this molecule and Wednesday's Nobel Laureate(s). Your task is to figure out the significance of today's molecule and identify the Nobel Laureate(s) who worked out the function of the molecule.

The reward goes to the person who correctly identifies the molecule and the Nobel Laureate(s). Previous winners are ineligible for one month from the time they first collected the prize. There are two ineligible candidates for this week's reward. The prize is a free lunch at the Faculty Club.

Send your guess to Sandwalk (sandwalk(at)bioinfo.med.utoronto.ca) and I'll pick the first email message that correctly identifies the molecule and the Nobel Laureate(s). Correct responses will be posted tomorrow along with the time that the message was received on my server. I may select multiple winners if several people get it right.

Comments will be blocked for 24 hours. Comments are now open.

UPDATE: No winner this week. Several people got the correct molecule—it's the semiquinone form of flavin mononucleotide (FMN). One person guessed the Nobel Laureate but did not get the molecule correct.

---

Monday's Molecule #179

Last week we discovered two chemically similar reactions that were catalyzed by related enzymes of the same gene family [Monday's Molecule #178]. Today's molecule is a lot more important than any of the four molecules from last week although you won't find it in most biochemistry textbooks. (Surprise! It's in my book.)

What is this molecule (IUBMB name) and why is it important?

Post your answer as a comment. I'll hold off releasing any comments for 24 hours. The first one with the correct answer wins. I will only post mostly correct answers to avoid embarrassment. The winner will be treated to a free lunch with a very famous person, or me.

There could be two winners. If the first correct answer isn't from an undergraduate student then I'll select a second winner from those undergraduates who post the correct answer. You will need to identify yourself as an undergraduate in order to win. (Put "undergraduate" at the bottom of your comment.)

Some past winners are from distant lands so their chances of taking up my offer of a free lunch are slim. (That's why I can afford to do this!)

In order to win you must post your correct name. Anonymous and pseudoanonymous commenters can't win the free lunch.

Winners will have to contact me by email to arrange a lunch date. Please try and beat the regular winners. Most of them live far away and I'll never get to take them to lunch. This makes me sad.

Comments are invisible for 24 hours. Comments are now open.

UPDATE: The molecule is 2-carboxy-3-ketoarabinitol 1,5-bisphosphate, an intermediate in the reaction catalyzed by rubisco (ribulose 1,5-bisphosphate carbozylase-oxygenase). This is the main enzyme responsible for carbon dioxide fixation in plants and one of the most enzymes on the planet.

This week's winners are Bill Chaney and Raul A. Félix de Sousa.

Winners
Nov. 2009: Jason Oakley, Alex Ling
Oct. 17: Bill Chaney, Roger Fan
Oct. 24: DK
Oct. 31: Joseph C. Somody
Nov. 7: Jason Oakley
Nov. 15: Thomas Ferraro, Vipulan Vigneswaran
Nov. 21: Vipulan Vigneswaran (honorary mention to Raul A. Félix de Sousa)
Nov. 28: Philip Rodger
Dec. 5: 凌嘉誠 (Alex Ling)
Dec. 12: Bill Chaney
Dec. 19: Joseph C. Somody
Jan. 9: Dima Klenchin
Jan. 23: David Schuller
Jan. 30: Peter Monaghan
Feb. 7: Thomas Ferraro, Charles Motraghi
Feb. 13: Joseph C. Somody
March 5: Albi Celaj
March 12: Bill Chaney, Raul A. Félix de Sousa
March 19: no winner
March 26: John Runnels, Raul A. Félix de Sousa
April 2: Sean Ridout
April 9: no winner
April 16: Raul A. Félix de Sousa
April 23: Dima Klenchin, Deena Allan
April 30: Sean Ridout
May 7: Matt McFarlane
May 14: no winner
May 21: no winner
May 29: Mike Hamilton, Dmitri Tchigvintsev
June 4: Bill Chaney, Matt McFarlane
June 18: Raul A. Félix de Sousa
June 25: Raul A. Félix de Sousa
July 2: Raul A. Félix de Sousa
July 16: Sean Ridout, William Grecia
July 23: Raul A. Félix de Sousa
July 30: Bill Chaney and Raul A. Félix de Sousa

---

Monday's Molecule #21

 

Name this molecule. You must be specific but we don't need the full correct scientific name. (If you know it then please post it.)

As usual, there's a connection between Monday's molecule and this Wednesday's Nobel Laureate. This one's easy once you know the molecule and make the connection. The prize (free lunch) goes to the person who correctly identifies both the molecule and the Nobel Prize.

Comments will be blocked for 24 hours.Comments are now open.

Monday's Molecule #78

 
Today is Tuesday so, once again, it's time for Monday's Molecule.¹

This time there are two molecules and you have to get them both right in order to win. We'll need complete and accurate common names and IUPAC names. The two molecules have something in common, they belong to the same class of compounds. Can you guess what class it is?

As always, there's a connection between today's molecule and a Nobel Prize. The prize was awarded for being the first scientist to recognize that these molecules exist in nature and play an important role in biology. The structure of the molecules was not known when the Nobel Prize was awarded.

The first person to correctly identify the molecules and name the Nobel Laureate(s), wins a free lunch at the Faculty Club. Previous winners are ineligible for one month from the time they first collected the prize. There are four ineligible candidates for this week's reward. You know who you are.

THEME:

Nobel Laureates
Send your guess to Sandwalk (sandwalk (at) bioinfo.med.utoronto.ca) and I'll pick the first email message that correctly identifies the molecule and names the Nobel Laureate(s). Note that I'm not going to repeat Nobel Laureate(s) so you might want to check the list of previous Sandwalk postings by clicking on the link in the theme box.

Correct responses will be posted tomorrow. I may select multiple winners if several people get it right.

Comments will be blocked for 24 hours. Comments are now open.

UPDATE: This week's winner is Neel Patel. Here's his answer ..

Both molecules are fat-soluble vitamins.

The first molecule is Vitamin D3, or cholecalciferol. The IUPAC name is (3â,5Z,7E)-9,10-secocholesta-5,7,10(19)-trien-3-ol.

The second is Vitamin A, or retinol. The IUPAC name is (2E,4E,6E,8E) -3,7-dimethyl-9- (2,6,6-trimethylcyclohex-1-enyl) -nona-2,4,6,8-tetraen-1-ol

The Nobel Prize in Physiology or Medicine in 1929 pertinent to the above two molecules was awarded to Sir Frederick Gowland Hopkins, who was the first to propose the existence of vitamins, which he termed "accessory factors".

---

1. I took a day off from posting, just because I was lazy and it was a holiday.

Monday's Molecule #107

 
This Monday's "molecule" looks a lot like an electron micrograph of a cell instead of a molecule. That's because it's hard to connect a specific molecule with some Nobel Laureates. Your task today is to identify the two things identified by the red and blue arrows.

There's one Nobel Laureate who is closely identified with the discovery of these two things. Name this Nobel Laurete.

The first person to identify the images and the Nobel Laureate wins a free lunch at the Faculty Club. Previous winners are ineligible for one month from the time they first won the prize.

There are eight ineligible candidates for this week's reward: Bill Chaney of the University of Nebraska, Maria Altshuler of the University of Toronto, Ramon, address unknown, Jason Oakley of the University of Toronto, John Bothwell from the Marine Biological Association of the UK, in Plymouth (UK), Wesley Butt of the University of Toronto, David Schuller of Cornell University, and Nova Syed of the University of Toronto.

Bill, John, and David have offered to donate their free lunch to a deserving undergraduate so the next two undergraduates to win and collect a free lunch can also invite a friend. Since undergraduates from the Toronto region are doing better in this contest, I'm going to continue to award an additional free lunch to the first undergraduate student who can accept a free lunch. Please indicate in your email message whether you are an undergraduate and whether you came make it for your free lunch (with a friend).

THEME:

Nobel Laureates
Send your guess to Sandwalk (sandwalk (at) bioinfo.med.utoronto.ca) and I'll pick the first email message that correctly identifies the molecule and names the Nobel Laureate(s). Note that I'm not going to repeat Nobel Laureate(s) so you might want to check the list of previous Sandwalk postings by clicking on the link in the theme box.

Correct responses will be posted tomorrow. I reserve the right to select multiple winners if several people get it right.

Comments will be blocked for 24 hours.

---

Monday's Molecule #190

Last week's molecule was carnitine (3-hydroxy-4-(trimethylazaniumyl)butanoate) or carnitine. The winner was Raúl Mancera [Monday's Molecule #189].

Name this week's molecule. Be sure to give an unambiguous name—it can be the common name or the IUPAC name. Why is this molecule important in some species?

Post your answer as a comment. I'll hold off releasing any comments for 24 hours. The first one with the correct answer wins. I will only post mostly correct answers to avoid embarrassment. The winner will be treated to a free lunch.

There could be two winners. If the first correct answer isn't from an undergraduate student then I'll select a second winner from those undergraduates who post the correct answer. You will need to identify yourself as an undergraduate in order to win. (Put "undergraduate" at the bottom of your comment.)

Monday's Molecule #30

 
Today's molecule looks complicated but it has a very simple, and well-known, name. We need the correct common name and the long systematic (IUPAC) name.

As usual, there's a connection between Monday's molecule and this Wednesday's Nobel Laureate(s). This one is an obvious direct connection. Once you have identified the molecule the Nobel Laureate(s) are obvious.

The reward (free lunch) goes to the person who correctly identifies the exact molecule with the correct formal name and the Nobel Laureate(s). Previous free lunch winners are ineligible for one month from the time they first collected the prize. There are no ineligible candidates for this Wednesday's reward since recent winners have declined the prize on the grounds that they live in another country and can't make it for lunch on Thursday (a feeble excuse, in my opinion).

Comments will be blocked for 24 hours. Comments are now open.

Monday's Molecule #73

 
Today's molecule is rather large but it's made up of only two different macromolecules. It has been a favorite molecule of many famous scientists. Several fundamental advances in our understanding of biochemistry and molecular biology have come from studies of this molecules and its components.

You need to identify the molecule and give its correct common name. We don't need the formal IUPAC name in this case, because there isn't one!. Pay attention to the correct common name—you may not be able to guess it just by looking at the molecule but you should be able to deduce it knowing that it is connected to a Nobel Prize.

There's an direct connection between today's molecule and a Nobel Prize. The prize was awarded for purifying the molecule and determining its composition. The first person to correctly identify the molecule and name the Nobel Laureate(s) wins a free lunch at the Faculty Club. Previous winners are ineligible for one month from the time they first collected the prize. There are four ineligible candidates for this week's reward.

THEME:

Nobel Laureates
Send your guess to Sandwalk (sandwalk (at) bioinfo.med.utoronto.ca) and I'll pick the first email message that correctly identifies the molecule and names the Nobel Laureate(s). Note that I'm not going to repeat Nobel Laureate(s) so you might want to check the list of previous Sandwalk postings by clicking on the link in the theme box.

Correct responses will be posted tomorrow. I may select multiple winners if several people get it right.

Comments will be blocked for 24 hours. Comments are now open.

UPDATE: The molecule is tobacco mosaic virus (TMV). The Noble Laureate is Wendell Meredith Stanley (Chemistry 1946). There were quite a few readers who got it right but the first one was John Dennehy of CUNY New York (USA). Congratulations John! He has already declined my offer of lunch on Thursday and taken a rain check to be cashed the next time he's in Toronto.

---

Monday's Molecule #136: Winner!

 
This is the Golgi apparatus. It's responsible for sorting and targeting proteins that have to be secreted or localized to internal vesicles. These proteins are inserted into the lumen of the endoplasmic reticulum (ER) during protein biosynthesis and from there they are partially modified and shuffled off to the Gorgi in small vesicles that bud off the ER and fuse with the membrane stacks shown in the image. While in the Gogi the proteins are further modified and targeted to the cell surface or peroxisomes or lysozomes. They travel to those locations in vesicles that bud off the edges of the Golgi disks.

The Nobel Laureate is Camillo Golgi who discovered the Golgi apparatus over 115 years ago.

This week's winner is Ben Ryan, an undergraduate from the University of North Carolina at Chapel Hill. He's the son of an old friend who's now the Managing Editor of American Scientist. It's scary when you realize that people who you remember as toddlers are now university students who can correctly answer Monday's Molecule. I'm hoping that Ben will be able to visit Toronto and collect his prize. I have stories to tell him that I can't put in writing.

---

Today's "molecule" is an easy one in celebration of the start of a new academic year for many university students. Name this structure and provide a very brief description of it's function.

The Nobel Laureate should be obvious.

The first person to describe the "molecule" and name the Nobel Laureate wins a free lunch. Previous winners are ineligible for six weeks from the time they first won the prize.

There are only three ineligible candidates for this week's reward: Markus-Frederik Bohn of the Lehrstuhl für Biotechnik in Erlangen, Germany, Maria Altshuler of the University of Toronto, and Philip Johnson of the University of Toronto.

I have an extra free lunch for a deserving undergraduate so I'm going to continue to award an additional prize to the first undergraduate student who can accept it. Please indicate in your email message whether you are an undergraduate and whether you can make it for lunch.

THEME:

Nobel Laureates
Send your guess to Sandwalk (sandwalk (at) bioinfo.med.utoronto.ca) and I'll pick the first email message that correctly identifies the molecule(s) and names the Nobel Laureate(s). Note that I'm not going to repeat Nobel Prizes so you might want to check the list of previous Sandwalk postings by clicking on the link in the theme box.

Correct responses will be posted tomorrow.

Comments will be blocked for 24 hours. Comments are now open.

---

Monday's Molecule #39

 
Today's molecule is complex but it has a very simple common name. The common name is not sufficient—you must supply the formal IUPAC name to win the prize. There's a direct connection between this Monday's Molecule and Wednesday's Nobel Laureate.

The reward (free lunch) goes to the person who correctly identifies the molecule and the Nobel Laureate(s). Previous free lunch winners are ineligible for one month from the time they first collected the prize. There's only one (Marc) ineligible candidate for this Wednesday's reward since many recent winners haven't collected their prize. The prize is a free lunch at the Faculty Club.

In preparation for the beginning of classes in three weeks I'm going to start requesting email responses. Send your guess to Sandwalk (sandwalk(at)bioinfo.med.utoronto.ca) and I'll pick the first email message that correctly identifies the molecule and the Nobel Laureate. All responses will be posted tomorrow along with the time that their message was received on my server. This way I may select multiple winners if several people get it right.

Comments will be blocked for 24 hours. Comments are now open.

Monday's Molecule #191

Last week's molecule was L-dopa. The winner was Raul A. Félix de Sousa (again, but this time only by four minutes!) [Monday's Molecule #190].

This week's molecule is much more complicated and it's also much more important. You need to identify this complex making sure you distinguish it from other similar complexes. You don't need to name the exact species but you should have some idea of which organisms have this complex and which ones don't. There's not enough room in the comments for the complete IUPAC name!

You'll get special bonus points (and the expensive lunch in the dining room instead of the pub) for explaining how an irreducibly complex structure like this could have evolved.

Post your answer as a comment. I'll hold off releasing any comments for 24 hours. The first one with the correct answer wins. I will only post mostly correct answers to avoid embarrassment. The winner will be treated to a free lunch.

There could be two winners. If the first correct answer isn't from an undergraduate student then I'll select a second winner from those undergraduates who post the correct answer. You will need to identify yourself as an undergraduate in order to win. (Put "undergraduate" at the bottom of your comment.)

Monday's Molecule #34

 
Today's molecule is very simple. It is well-known to all biochemistry undergraduates—or at least it was well-known at the time they wrote the exam. Let's see how many of you remember it today.

Today we need the formal IUPAC name in order to win the prize. There's an extremely obvious connection between this Monday's Molecule and Wednesday's Nobel Laureate. You will owe me a lunch if you guess the molecule correctly but can't figure out who the Nobel Prizewinner(s) is/are.

The reward (free lunch) goes to the person who correctly identifies the molecule and the Nobel Laureate(s). Previous free lunch winners are ineligible for one month from the time they first collected the prize. There are no ineligible candidates for this Wednesday's reward since many recent winners haven't collected their prize. The prize is a free lunch at the Faculty Club.

Comments will be blocked for 24 hours. Comments are now open.

Monday's Molecule #20

 
Name this molecule. The figure doesn't show the precise structure of the complete molecule but there's enough of a hint for you to figure it out. In this case we don't need a precise scientific name.

As usual, there's a connection between Monday's molecule and this Wednesday's Nobel Laureate but this one is very indirect. Nobody will be able to guess it. The bonus lunch date will be awarded to the first person to make the connection between this molecule and the University of Toronto.

Comments will be blocked for 24 hours. Comments are now open.

Monday's Molecule #100

 
This is the 100th edition of Monday's Molecule! Today's "molecule" is a chemical reaction in several steps.

Your task is to identify what's going on and relate it to a single Nobel Laureate.

The first one to correctly identify the molecule and name the Nobel Laureate, wins a free lunch at the Faculty Club. Previous winners are ineligible for one month from the time they first collected the prize. There are four ineligible candidates for this week's reward: Dale Hoyt from Athens, Georgia, Ms. Sandwalk from Mississauga, Ontario, Canada, Alex Ling of the University of Toronto, and Timothy Evans of the University of Pennsylvania. Dale and Ms. Sandwalk have offered to donate the free lunch to a deserving undergraduate so the first two undergraduates to win and collect a free lunch can also invite a friend. Alex gets the first one.

THEME:

Nobel Laureates
Send your guess to Sandwalk (sandwalk (at) bioinfo.med.utoronto.ca) and I'll pick the first email message that correctly identifies the "molecule" and names the Nobel Laureate(s). Note that I'm not going to repeat Nobel Laureate(s) so you might want to check the list of previous Sandwalk postings by clicking on the link in the theme box.

Correct responses will be posted tomorrow. I reserve the right to select multiple winners if several people get it right.

Comments will be blocked for 24 hours. Comments are now open.

UPDATE: The reactions lead to cleavage of DNA at G residues. This is part of the chemical sequencing strategy developed by Maxam and Gilbert in 1976. The Nobel Laureate is Walter Gilbert.

I was surprised at how many old fogies well-established scientists read Sandwalk. We have now produced an entire generation of scientists who will have never experienced this sequencing method but, nevertheless, the correct answers flooded in within a few hours. The first was from John Bothwell of the Marine Biological Association of the UK in Plymouth, UK. Congratulations! Are you free for lunch tomorrow, John, or do you want to take a rain check?

---

Monday's Molecule #23

 
Name this molecule. It's related to last week's theme on pyruvate and pyruvate dehydrogenase.

As usual, there's a connection between Monday's molecule and this Wednesday's Nobel Laureate. This one's got something to do with the type of reactions that involve today's molecule. The prize (free lunch) goes to the person who correctly identifies both the molecule and the Nobel Laureate. (Previous free lunch winners are ineligible for one month from the time they first won.)

Comments will be blocked for 24 hours. Comments are now open.

Monday's Molecule #40

 

Name this molecule. There's a short common name but it's not sufficient. You have to supply the complete IUPAC name in order to win the prize. There's a direct connection between this Monday's Molecule and Wednesday's Nobel Laureate(s).

The reward goes to the person who correctly identifies the molecule and the Nobel Laureate(s). Previous free lunch winners are ineligible for one month from the time they first collected the prize. There are two ineligible candidates for this Wednesday's reward. Both of them are waiting to collect their prize when September rolls around. The prize is a free lunch at the Faculty Club.

Send your guess to Sandwalk (sandwalk(at)bioinfo.med.utoronto.ca) and I'll pick the first email message that correctly identifies the molecule and the Nobel Laureate. Correct responses will be posted tomorrow along with the time that the message was received on my server. This way I may select multiple winners if several people get it right.


Comments will be blocked for 24 hours. Comments are now open.

Monday's Molecule #182

Last week's molecule was a ganglioside (G_M2) that's associated with Tay-Sachs disease [Monday's Molecule #181].

This week's molecule is one of the most important enzymes in the known universe. What is it?

Post your answers as a comment. I'll hold off releasing any comments for 24 hours. The first one with the correct answer wins. I will only post mostly correct answers to avoid embarrassment. The winner will be treated to a free lunch.

There could be two winners. If the first correct answer isn't from an undergraduate student then I'll select a second winner from those undergraduates who post the correct answer. You will need to identify yourself as an undergraduate in order to win. (Put "undergraduate" at the bottom of your comment.)

Some past winners are from distant lands so their chances of taking up my offer of a free lunch are slim. (That's why I can afford to do this!)

In order to win you must post your correct name. Anonymous and pseudoanonymous commenters can't win the free lunch.

Winners will have to contact me by email to arrange a lunch date. Please try and beat the regular winners. Most of them live far away and I'll never get to take them to lunch. This makes me sad.

Comments are invisible for 24 hours. Comments are now open.

UPDATE: The molecule is complex III or ubiquinol:cytochrome c oxidoreductase, the enzyme responsible for the Q-cycle and the transport of proton across the plasma membrane of bacteria and the inner mitochondrial membrane in eukaryotes. This week's winner is Stephen Spiro.

Winners
Nov. 2009: Jason Oakley, Alex Ling
Oct. 17: Bill Chaney, Roger Fan
Oct. 24: DK
Oct. 31: Joseph C. Somody
Nov. 7: Jason Oakley
Nov. 15: Thomas Ferraro, Vipulan Vigneswaran
Nov. 21: Vipulan Vigneswaran (honorary mention to Raul A. Félix de Sousa)
Nov. 28: Philip Rodger
Dec. 5: 凌嘉誠 (Alex Ling)
Dec. 12: Bill Chaney
Dec. 19: Joseph C. Somody
Jan. 9: Dima Klenchin
Jan. 23: David Schuller
Jan. 30: Peter Monaghan
Feb. 7: Thomas Ferraro, Charles Motraghi
Feb. 13: Joseph C. Somody
March 5: Albi Celaj
March 12: Bill Chaney, Raul A. Félix de Sousa
March 19: no winner
March 26: John Runnels, Raul A. Félix de Sousa
April 2: Sean Ridout
April 9: no winner
April 16: Raul A. Félix de Sousa
April 23: Dima Klenchin, Deena Allan
April 30: Sean Ridout
May 7: Matt McFarlane
May 14: no winner
May 21: no winner
May 29: Mike Hamilton, Dmitri Tchigvintsev
June 4: Bill Chaney, Matt McFarlane
June 18: Raul A. Félix de Sousa
June 25: Raul A. Félix de Sousa
July 2: Raul A. Félix de Sousa
July 16: Sean Ridout, William Grecia
July 23: Raul A. Félix de Sousa
July 30: Bill Chaney and Raul A. Félix de Sousa
Aug. 7: Raul A. Félix de Sousa
Aug. 13: Matt McFarlane
Aug. 20: Stephen Spiro

---

Monday's Molecule #192

Last week's molecule was photosystem I (PSI). Mikkel Rasmussen was the only one to get it right [Monday's Molecule #191].

I thought of this week's molecule while I was in Los Angeles last week. We got to sample some excellent examples of cuisine that's hard to find in Toronto. You need to supply the common name AND the formal IUPAC name.

Post your answer as a comment. I'll hold off releasing any comments for 24 hours. The first one with the correct answer wins. I will only post mostly correct answers to avoid embarrassment. The winner will be treated to a free lunch.

There could be two winners. If the first correct answer isn't from an undergraduate student then I'll select a second winner from those undergraduates who post the correct answer. You will need to identify yourself as an undergraduate in order to win. (Put "undergraduate" at the bottom of your comment.)

Monday's Molecule #84

 
Continuing with our Olympics theme, this is another molecule that many athletes fear. As with last week's molecule, the competitors in Beijing do not want to be caught with too much of this in their bodies. You probably won't recognize this molecule from the structure so there's a really big clue below.

You need to identify the specific molecule shown here and explain why this might be an important molecule at the Olympics. Be careful to get the name correct as there are several close relatives that might confuse you.

MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

The connection between today's molecule and a Nobel Prize is quite indirect. The Nobel Prize was awarded for developing a very sensitive assay to detect these types of molecules. We don't know if the same assay is being used in the Olympics—probably not.

The first person to correctly identify the molecule and name the Nobel Laureate(s), wins a free lunch at the Faculty Club. Previous winners are ineligible for one month from the time they first collected the prize. There are three ineligible candidates for this week's reward. You know who you are.

THEME:

Nobel Laureates
Send your guess to Sandwalk (sandwalk (at) bioinfo.med.utoronto.ca) and I'll pick the first email message that correctly identifies the molecule and names the Nobel Laureate(s). Note that I'm not going to repeat Nobel Laureate(s) so you might want to check the list of previous Sandwalk postings by clicking on the link in the theme box.

Correct responses will be posted tomorrow. I reserve the right to select multiple winners if several people get it right.

Comments will be blocked for 24 hours. Comments are now open.

UPDATE: This week's winner is Mike Fraser who wrote, "The molecule is human growth hormone 1, which can be (mis)used to enhance
muscle mass and strength in athletes. Obviously, this would constitute
illegal doping at the Olympics; athletes would not want to be caught with too
much hGH.

The Nobelist is Rosalyn Yalow, 1977 (Medicine) for the development of the
radioimmunoassay of peptide hormones, such as hGH."

Congratulations Mike!

---

Monday's Molecule #225

Last week's molecule was EF-Tu (elongation factor-thermo unstable). EF-Tu binds to all tRNA molecules in the cell and helps position them in the A-site of the ribosome-mRNA complex during protein synthesis. Its release is coupled to GTP hydrolysis. Eukaryotes contain homologous proteins with different names (e.g. EF-1α). The winner was Jon Nuelle from Texas. The undergraduate winner was Ariel Gershon for the second week in a row.

Today's molecule (below) is an intermediate in a very important pathway that's only found in some species. This is one of those times when you need to supply the common name AND the correct scientific name that specifies the exact molecule shown in the figure.

Email your answer to me at: Monday's Molecule #225. I'll hold off posting your answers for at least 24 hours. The first one with the correct answer wins. I will only post the names of people with mostly correct answers to avoid embarrassment. The winner will be treated to a free lunch.

There could be two winners. If the first correct answer isn't from an undergraduate student then I'll select a second winner from those undergraduates who post the correct answer. You will need to identify yourself as an undergraduate in order to win. (Put "undergraduate" at the bottom of your email message.)