More Recent Comments

Sunday, August 24, 2008

Nobel Laureate: Rosalyn Yalow

 

The Nobel Prize in Physiology or Medicine 1977.
"for the development of radioimmunoassays of peptide hormones"


Rosalyn Yalow (1921 - ) received the Nobel Prize in Physiology or Medicine for developing an assay to detect small quantities of peptide hormones. Her coworker and collaborator, Solomon Berson, died before the prize was awarded; otherwise he would have been included.

Yalow shared the Nobel Prize with Roger Guillemin and Andrew V. Schally.

The presentation speech was delivered in Swedish by Professor Rolf Luft of the Karolinska Medico-Chirurgical Institute.

THEME:
Nobel Laureates
Your Majesties, Your Royal Highnesses, Ladies and Gentlemen,

The word "hormones" and associated terms have always stimulated our fantasy. The mystery in connection with hormones has been, from the beginning, equally overwhelming to the researcher and the layman. It is easy to understand why. These were chemical substances with often very powerful actions at concentrations which for a long time seemed so low that they were impossible to measure. However, mystery and belief lead nowhere, at least not in scientific research and medicine. Once one learned to identify the active chemical substances - in this case hormones - and to measure their rate of synthesis, only then did one establish a firm basis for turning fantasy and mystery into reality.

This year's three Nobel laureates in medicine have all made contributions which are outstanding examples of this kind of activity. Rosalyn Yalow's name is for ever associated with her methodology of measuring the presence of hormones in the blood at concentrations as low as one thousand billionths of a gram per milliliter of blood. This was a necessity, since a great many hormones, primarily the so-called protein hormones, are present in the blood in such small quantities. Before Yalow, these hormones could not be determined quantitatively in the blood, and therefore, active research in this field had stagnated.

Rosalyn Yalow and Solomon Berson, her late coworker, discovered by chance that one small protein hormone, insulin, following injection into man resulted in a production of antibodies against insulin. All diabetics who receive insulin develop similar antibodies against the administered insulin. The discovery by Yalow and Berson was unacceptable at first - their first scientific paper concerning this observation was even refused publication - since it was commonly believed that proteins as small as these protein hormones were unable to stimulate antibody formation. However, Yalow and Berson did not give up, and furthermore, after a couple of years of intensive work, they presented in 1960 a methodology for the determination of protein hormones in the blood, the fundamental principle of which utilized the ability of these hormones to stimulate antibody formation in man. This methodology, known as the Yalow-Berson method, is genial in all its simplicity, and can even be described in simple terms.

As a result of mixing in a test tube a known quantity of radioactive insulin with a known quantity of antibodies against insulin, a specific amount of the insulin becomes attached to these antibodies. Subsequently, if one adds to this mixture a small amount of blood which contains insulin, the insulin of the blood becomes similarly attached to the antibodies and a certain portion of the radioactive insulin is detached from the antibodies. The higher the concentration of insulin is in the blood sample, the larger is the amount of radioactive insulin that will be detached from the antibodies. The amount of radioactive insulin thus removed can easily be determined, providing an exact measure of the amount of insulin present in the blood sample.

The Yalow-Berson method which makes it possible to determine the exact amounts of all hormones present, represented a real revolution in the field of hormone research. A field where one refers to the time period before Yalow, and the new epoch which began with her achievement. Her methodology and the modifications thereof, subsequently made their triumphant journey far beyond her own field of research, reaching into vast territories of biology and medicine. It has been said that Yalow changed the life of a multitude of researchers within these fields. Rarely have so many had so few to thank for so much.

Roger Guillemin and Andrew Schally have also contributed greatly to this field of research, exploring protein hormones. It is justifiable to say that they have uncovered a substantial part of the link between body and soul.

For decades, one has talked about the indivisible homo sapiens, maintaining that our body and soul can not be separated since they form an entity. Emotional and psychic phenomena do influence our bodily functions. Let me give you an example. When American soldiers were sent to the European war scene, thousands of female companions who were left behind, stopped menstruation. They were completely healthy, but the emotional stress had an influence on certain body functions, causing these functions to cease. Through which mechanisms did the psyche thus influence the body?

Psychic phenomena as well as input from the entire body bring about electrical impulses in the brain. This is the language of the nervous system, the brain speaks "electrically". The brain informs some of its centers of what is going on, and these centers relay the message further. Those centers which pass on the information to the hormone producing organs of the body are situated in the midbrain, an area on the base of the brain. Delicate blood vessels in turn connect the midbrain with the pituitary, an important hormone producing gland, often referred to as the hypophysis. This sequence provides the pathway for transmission of information from the surroundings to the brain, to the midbrain, to the pituitary, and thus to all those bodily functions which are influenced and controlled by hormones.

By the mid 1950's it was evident - also here through the contributions of Guillemin and Schally - that the midbrain produces chemical substances which are transported to the pituitary via the delicate blood vessels just mentioned. Once in the pituitary, they determine the exact quantities of the various hypophyseal hormones which must be produced at a given point in time. But which were these substances in the midbrain, evidently passing the information from soul to body?

Guillemin and Schally worked independently in different parts of the U.S.A. together with their large staff of coworkers, trying to isolate one of these chemical substances, and both researchers concentrated on the same substance. Each started with five million pieces taken from the midbrain of sheeps and pigs - half a ton - and in 1969, after years of arduous labor, they each came up with 1 milligram of the purified hormonal substance. Rarely have so many gained so little from so much.

Guillemin and Schally were the first to isolate several of the communicating chemical links between the brain and the pituitary, and they also determined their structure and succeeded in synthesizing them.

The discoveries by Guillemin and Schally brought on a revolution in their own field of research. Still other protein hormones have subsequently been isolated from the midbrain, this wondrous organ of control and guidance which today - more than ever - emerges as part of the link between the body (soma) and the soul (brain).

Rosalyn Yalow, Roger Guillemin, Andrew Schally: the road of every scientist is paved by frustration. But some reach the goal they have set up and enjoy the pleasure and excitement of having learned something that no one knew before, and for that enjoy imperishable honor in the learned world.

Few ever reach the point at which you have arrived: to undertake a formidable task and to come to a solution, which not only attracts the admiration of your scientific colleagues, but which - in the best spirit of Alfred Nobel - also contains a possibility to understand the structure of human life and human behaviour.

The Karolinska Institute is happy to be able to award you this year's Nobel Prize in Physiology or Medicine for your contributions and congratulates you. May I now ask you to receive the insignia of the Nobel Prize from His Majesty, the King.


The Olympics Is Over: Who Won?

 
I haven't been following all that closely so I appreciate the effort made by John Wilkins to summarize the data. I hope he doesn't mind that I stole his graph from The real Olympic performers. All we have to do now is integrate the medals from the summer and winter olympic games to see the overall winners.

Congratulations to Jamaica for a well-deserved victory in Beijing.



There Was no Timmy's at Chautauqua

 
There was no Tim Horton's at Chautauqua. The local coffee kiosk served coffee made by someone called Starbuck—or something similar. Every time I visit America I have to re-learn the language. I think I've almost got it. "Tall" means small. "Grande" means regular. And I've already forgotten what "vente" means.

I was so glad to get back to civilization yesterday and get a decent coffee in an extra large cup. (And a Boston creme donut.)



Saturday, August 23, 2008

Carl Zimmer at Chautauqua

 
Carl Zimmer gave a talk in the Hall of Philosophy on Tuesday afternoon. The photo isn't very good because I forgot my camera and had to use my cell phone.

Carl posted his talk on The Loom [Darwin, Linnaeus, and One Sleepy Guy]. He said many important things about Darwin and evolutionary biology. As a matter of fact, of all the speakers who talked about evolutionary biology, Carl was one of only two speakers who got the basics correct.1

Here's what he said in the first minute ...
We are now descending into a frenzy of Darwin celebrations, and you’re not going to escape it until the end of 2009. We’ve got his 200th birthday in February, and the 150th anniversary of the publication of the Origin of Species in November. The spotlight is going to be on Darwin, and Darwin alone.

I think this is a mistake. Darwin deserves celebrating, but that doesn’t mean we should fall prey to a cult of personality. Darwin did not invent biology. Darwin did not even find most of the evidence that he used to back up his theory of evolution. And he certainly did not discover all there was to know about evolution. Biologists have discovered many new things about evolution since his time. In some cases, they’ve challenged some of his most important arguments. And that’s fine. That’s the great strength of science.
This reflects one of the main themes in the two courses that I taught at Chautauqua; namely, that Darwin was the greatest scientist who ever lived but we have moved far beyond what Darwin knew in 1859.

The other important point is that we risk over-emphasizing Darwin during the celebrations next year. According to Stephen Jay Gould, this is what happened in 1959 during the 100th anniversary celebrations. The result was a hardening of the Modern Synthesis and the rise of adaptationism.2 I'm so glad Carl made this point. I think we all have to be careful judging by what I saw during the rest of the week and what I witnessed at a celebration of Darwin here in Toronto [Darwinism at the ROM]. Please, let's try and keep things in perspective. Whenever we praise Darwin we should also mention that modern evolutionary biology has incorporated his important contributions but added much more.

Later that night I met Carl for a few beers (three for me and decaf coffee wine for him). We had a wonderful three hours discussing evolution with Beth Shapiro and her husband—an informed engineer! Turns out, Carl is not quite as nice as he appears on his blog. In person, he actually has firm opinions about some of things he avoids discussing on The Loom.

Please don't tell him I said that. And whatever you do, don't tell him that I actually agree with some of the things he said.

We also talked about writing trade books. He convinced me that I should give it a try even though it's not nearly as rewarding3 as writing a textbook.


1. The other one was Genie Scott.

2. The original Modern Synthesis of the 1940's was pluralistic.

3. Financially.

Beth Shapiro at Chautauqua

 
Beth Spiro is a Professor at Pennsylvania State University: Her field of expertise is the study of ancient DNA (fossil DNA) in order to learn how organisms, and species, responded to changes in the environment [Molecular Evolution]. She told us about her field work in Siberia and how she collects material from fossilized wooley mammoths and other species that lived there before, during, and after the last ice age.

Beth is an entertaining lecturer. She's a little bundle of energy on the stage, wandering back and forth sharing her obvious joy in doing science (except for the mosquitoes). Although she is best known for How to Make a Dodo, on Tuesday morning she described ways in which she might bring a wooley mammoth back to life. The experiment was illustrated with 56(?) colored ribbons representing the wooley mammoth chromosomes. Many members of the audience got to hold a "mammoth chromosome." As it turns out, the experiment might be possible but it won't be easy.

Beth Shapiro is as bright and interesting in real life as she is on the stage. That evening I met Beth and her husband when Carl Zimmer brought her along for drinks after dinner. (She drinks beer. Carl doesn't.) It was a delightful evening. I'm so happy to have met her. I was even happier to learn that she actually reads blogs!


A Blog for Secular Students


 
Check out Edger, a Center for Inquiry student initiative.

About

Edger presents hard-hitting and reasoned news, views, and event promotion on issues pertaining to secularism, atheism, science, humanism, and the cosmos, and actively promotes and celebrates international freethought activism. Written in a youthful tone, but mature in content, Edger is sure to be a driving force in the new intellectual enlightenment.

Mission

To create an outlet for prominent young freethought leaders to express their views and get them heard. Blogs are becoming very commonplace, and alone many blogs fail, but together, with the proper direction and an engaging and professional site, these blogging leaders can come together to make an impact far beyond what they could have achieved on their own.


Convergence

 
Convergence is a hot topic these days because several theistic evolutionists are using it as scientific evidence for the existence of God.1

The most prominent scientists to fall into this trap are Ken Miller and Simon Conway Morris. Both of them are impressed by certain similarities between Australian marsupials and mammals in the rest of the world. Nobody seems to have noticed that there are no antelope-like or elephant-like species in Australia and no kangaroo-like species in Africa. And what about primates? If primates are so important then how come there are no intelligent primate-like marsupials?

I was going to write a lengthy article about the teleological fallacy behind these attempt to prove intelligent design but, as usual, PZ Myers beat me to it. (Does he ever sleep? Is there more than one of him?) Check out We don't need teleology — so why bother?.

The bigger question is whether scientists like Ken Miller and Simon Conway Morris (and Francis Collins) are (mis)using science to try and prove the existence of God. I think they are.


1. Strictly speaking, they are using it as evidence that there's a plan or purpose that's built into the laws of chemistry and physics. They may not specifically mention that the "grand design" is the work of God but nobody is fooled.

[Image Credit: BACKGROUNDERS]

Citation Classic: The Bible

 
This week's citation classic on The Evilutionary Biologist is the Bible. But it's not the bible you're thinking of.


Thursday, August 21, 2008

Not Just Education

 
The Chautauqua Institution isn't just about education. It has outstanding programs in dance, art, theater, and music. Every night there's some kind of performance going on in the amphitheater. Here's the lineup for this week.

Monday: 4:00 Chautauqua Wind Quintet, 8:15 PHILADANCO: The Philadelphia Dance Company

Tuesday: 8:15 Chautauqua Symphony Orchestra. Stefan Sanderling, conductor; Julie Albers, cello

Wednesday: 8:15 '100th Anniversary of the Great Automobile Race of 1908'

Thursday: 8:15 An Evening with Jim Brickman

Friday: 8:15 Special Acoustic Evening with Vince Gill

I'm going to everything, even Vince Gill. After all, when else do you get a chance to experience these things? It's not just because Ms. Sandwalk makes me go.

I couldn't resist taking a photo of this lady painting a picture of the Hall of Philosophy. It's soooo Chautauqua. (She gave me permission to take her picture.)




Wednesday, August 20, 2008

Monday, August 18, 2008

Science, Religion, and Separate Magisteria

 
In a recent interview, Daniel Dennett was asked about Gould's idea of non-overlapping magisteria. Here's his excellent reply [Daniel Dennett's Darwinian Mind: An Interview with a 'Dangerous' Man] ...

The problem with any proposed detente in which science and religion are ceded separate bailiwicks or "magisteria" is that, as some wag has put it, this amounts to rendering unto Caesar that which is Caesar's and unto God that which Caesar says God can have. The most recent attempt, by Gould, has not found much favor among the religious precisely because he proposes to leave them so little. Of course, I'm certainly not suggesting that he should have left them more.

There are no factual assertions that religion can reasonably claim as its own, off limits to science. Many who readily grant this have not considered its implications. It means, for instance, that there are no factual assertions about the origin of the universe or its future trajectory, or about historical events (floods, the parting of seas, burning bushes, etc.), about the goal or purpose of life, or about the existence of an afterlife and so on, that are off limits to science. After all, assertions about the purpose or function of organs, the lack of purpose or function of, say, pebbles or galaxies, and assertions about the physical impossibility of psychokinesis, clairvoyance, poltergeists, trance channeling, etc. are all within the purview of science; so are the parallel assertions that strike closer to the traditionally exempt dogmas of long-established religions. You can't consistently accept that expert scientific testimony can convict a charlatan of faking miracle cures and then deny that the same testimony counts just as conclusively—"beyond a reasonable doubt"—against any factual claims of violations of physical law to be found in the Bible or other religious texts or traditions.

What does that leave for religion to talk about? Moral injunctions and declarations of love (and hate, unfortunately), and other ceremonial speech acts. The moral codes of all the major religions are a treasury of ethical wisdom, agreeing on core precepts, and disagreeing on others that are intuitively less compelling, both to those who honor them and those who don't. The very fact that we agree that there are moral limits that trump any claim of religious freedom—we wouldn't accept a religion that engaged in human sacrifice or slavery, for instance—shows that we do not cede to religion, to any religion, the final authority on moral injunctions.
Most people don't understand that Gould advocated a very small magisterium for religion.


[Hat Tip: RichardDawkins.net]

Ken Miller at Chautauqua

 
The Chautauqua Institution is the ideal place for Ken Miller. Almost everyone here is religious and accepts science. I'm surrounded by theistic evolutionists.

Miller gave his usual talk about Intelligent Design and why it's not science. He described his role in the Dover trial. He spent some time explaining why Americans are more inclined to reject evolution. Basically it's the reason he explains in his book Only a Theory; namely that Americans are more independent than the citizens of other countries. This independence, and lack of respect for authority, is what makes America the greatest scientific nation in the world but, ironically, it also leads to the rejection of scientific authority by a majority of citizens. He didn't mention how scientists like Darwin and Linnaeus managed to do so well without ever visiting America.

He mentioned that he is religious and that science is compatible with religion (in his opinion). He did not explain his version of theistic evolution.



Monday's Molecule #84

 
Continuing with our Olympics theme, this is another molecule that many athletes fear. As with last week's molecule, the competitors in Beijing do not want to be caught with too much of this in their bodies. You probably won't recognize this molecule from the structure so there's a really big clue below.

You need to identify the specific molecule shown here and explain why this might be an important molecule at the Olympics. Be careful to get the name correct as there are several close relatives that might confuse you.

MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
The connection between today's molecule and a Nobel Prize is quite indirect. The Nobel Prize was awarded for developing a very sensitive assay to detect these types of molecules. We don't know if the same assay is being used in the Olympics—probably not.

The first person to correctly identify the molecule and name the Nobel Laureate(s), wins a free lunch at the Faculty Club. Previous winners are ineligible for one month from the time they first collected the prize. There are three ineligible candidates for this week's reward. You know who you are.

THEME:

Nobel Laureates
Send your guess to Sandwalk (sandwalk (at) bioinfo.med.utoronto.ca) and I'll pick the first email message that correctly identifies the molecule and names the Nobel Laureate(s). Note that I'm not going to repeat Nobel Laureate(s) so you might want to check the list of previous Sandwalk postings by clicking on the link in the theme box.

Correct responses will be posted tomorrow. I reserve the right to select multiple winners if several people get it right.

Comments will be blocked for 24 hours. Comments are now open.

UPDATE: This week's winner is Mike Fraser who wrote, "The molecule is human growth hormone 1, which can be (mis)used to enhance
muscle mass and strength in athletes. Obviously, this would constitute
illegal doping at the Olympics; athletes would not want to be caught with too
much hGH.

The Nobelist is Rosalyn Yalow, 1977 (Medicine) for the development of the
radioimmunoassay of peptide hormones, such as hGH."

Congratulations Mike!


Classroom at Chautauqua

 
This is Hultquist Center where many of the classrooms are located. It's also the headquarters of the Chautauqua Literary and Scientific Circle, a book club that's more than 120 years old.





Chautauqua Bookstore Is Ready for Evolution

 
The Chautauqua bookstore is ready for a week of evolution. There's going to be a lot of talk about the compatibility of science and religion so it's a bit disappointing to see that the atheist perspective isn't represented. A few weeks ago they had The God Delusion and God Is Not Great on display but now they are missing.